Phage RBP Database

UniProt accession

A0AAU8EBA7 [UniProt]

Protein name

Base plate tail tube protein

RBP type

TSP

Evidence RBPdetect

Probability 0,89

Seq2Symm

C1 confidence 0,149

C1	0,149
I	0,055
C2	0,008

Predicted homo-oligomer symmetry (Seq2Symm, per-class probabilities; C1 = monomer, C2 = dimer, C3 = trimer).

Protein sequence

MLYSLMRESRVVIEYEGRAYGFDALSDYTAGTSYEEFKANRRTIHRRSNYAYSKITAQSPSSISLTLNFSSNALEGIFFELMGFIEVDGMYQMPLFSNNIEPKMFSVYIINKNTSLRFDNCFATTCDFSLDKSVPVLNVGIESGYFEEVGHPLNSYTLDQGEVLPFSLPQVSSNGRVLPGLMSAGMSFQQQCEWRGDRSLFDINKIYNNRRAIVNELNSSALISMYYAKSLQIDSTHNIKPDMGLPVQIRNKYIVVDFPSTKITKRLDLTDVYKIDYDVIPIEQSDPVRIKLIGD

Physico‐chemical properties

protein length:	295 AA
molecular weight:	33575,76460 Da
isoelectric point:	5,37824
aromaticity:	0,11525
hydropathy:	-0,22441

Domain architecture

A0AAU8EBA7

1 295 aa

ATT 1–294 ·

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domains

IPR056389
ATT

IPR056389

A0AAU8EBA7

1295 aa

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domain annotations

Domain ID	Category	Cluster	Start	End	Layer	Name	Pref Zone	Confidence	Evidence	Support
IPR056389	ATT	DC_0131	1	294	InterPro cluster	Baseplate tube protein p140	Central	Medium	Text match	193 proteins / 193 hits

Proteins with similar domain architecture

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0AAU8EBA7

1 295 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	286	286	0,7012
Central domain	287	286	1	0,4907
C-terminal	287	295	8	0,6248

Note: Constraints were applied during segmentation.
Fixed 80 C-terminal predictions appearing before Central domain|C-terminal too short, adjusted boundary|CONSTRAINT VIOLATION: Final C-terminal (8 AA) is still below minimum (10 AA). Sequence may be too short.

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Phage

Klebsiella phage vB_Kpn13-P2 [NCBI] · taxon 3230841

No lineage information

Host

Klebsiella pneumoniae [NCBI] · taxon 573

cellular organisms Bacteria Pseudomonadati Pseudomonadota Gammaproteobacteria Enterobacterales

No CDS data available.

Protein

Domains

Tail Spike Domain Segmentation

Taxonomy

Coding sequence (CDS)

Genome Context

Tertiary structure

Predicted Aligned Error (PAE)