Phage RBP Database

UniProt accession

A0A6J5LTZ6 [UniProt]

Protein name

DUF7483 domain-containing protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

TF

Evidence RBPdetect2

Probability 0,92

Protein sequence

MFSSNTSQVSNAAVFVEDVFSTWLYTGNGSTQTINNGIDLAGKGGLVWIKQRSSTANHMLTDTARGTDFQLSSNSDVAQSNVTTRVTAFNADGFNLGASSAVNGSGSTYASWTFREQPKFFDVVTFTTGTSLSTNRRISHSLGSVPGCILVKRTTGAQSWLVYHRSTGRNAYLLLDTTEASTSFTNAWGTSDPTSTDFGINEDALCFPSSTYVAYLFAHNAGGFGLTGTDNVISCGSFTTDGSANATVELGWEPQWVMTKTIDAPGAWYMADTMRGWLGGVRPTSNQILYANLSNAEVNSSVFLGTVTATGFRPAMDAGTTSIYIAIRRGPMRTPTTGTSVYNAITRTGTGTEETITSIGFPPDLLDNQATTVSTFTGFFDRLRGGGRLLYRALSDPEVATGQTTQFNTTMSGFAVGASTAGDSGNNNGVPYVWHALRRAPSFFDEVCYTGTSVAGRTINHNLGVAPELMIVKVRSADNDWAVYSSTLGASNILYLNLASATSSTTTWNSTAPTATVFSVGSNLYANASGQTYVAYLFASCPGVSRVGSYTGTGATQTISCGFAARFVLIKRTDSVGNWWVWDTARGMVTGTDPRLAWNTTNSQFNNDWVFTNASGFQIVTTDATVNASGGSYIYLAIA

Physico‐chemical properties

protein length:	639 AA
molecular weight:	67903,21150 Da
isoelectric point:	5,72718
aromaticity:	0,11111
hydropathy:	-0,09280

Domain architecture

A0A6J5LTZ6

1 639 aa

STR 18–313 · STR 340–639

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domains

IPR055906
STR

IPR055906 IPR055906

IPR055906
STR

IPR055906

A0A6J5LTZ6

1639 aa

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domain annotations

Domain ID	Category	Cluster	Start	End	Layer	Name	Pref Zone	Confidence	Evidence	Support
IPR055906	STR	DC_0846	18	313	InterPro cluster	Domain of unknown function DUF7483	Central	Low	Positional only	51 proteins / 75 hits
IPR055906	STR	DC_0846	20	313	InterPro cluster	Domain of unknown function DUF7483	Central	Low	Positional only	51 proteins / 75 hits
IPR055906	STR	DC_0846	340	639	InterPro cluster	Domain of unknown function DUF7483	Central	Low	Positional only	51 proteins / 75 hits

Proteins with similar domain architecture

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A6J5LTZ6

1 639 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	10	10	0,0714
Central domain	11	209	200	0,0010
C-terminal	210	639	429	0,9990

Note: Constraints were applied during segmentation.
Sequence started with non-N-terminal domain

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Phage

uncultured Caudovirales phage [NCBI] · taxon 2100421

Uroviricota Caudoviricetes Peduoviridae Maltschvirus maltsch

Host No host information

No CDS data available.

Protein

Domains

Tail Spike Domain Segmentation

Taxonomy

Coding sequence (CDS)

Genome Context

Tertiary structure

Predicted Aligned Error (PAE)