Protein

View in Explore

Genbank accession

ANJ65185.1 [GenBank]

Protein name

tail spike protein

RBP type

Evidence UniProt/TrEMBL

Probability 1,00

TSP

Evidence Phold

Probability 1,00

Evidence RBPdetect

Probability 0,89

Evidence RBPdetect2

Probability 0,31

Seq2Symm

I confidence 0,982

I	0,982
C3	0,119
C2	0,002

Predicted homo-oligomer symmetry (Seq2Symm, per-class probabilities; C1 = monomer, C2 = dimer, C3 = trimer).

Protein sequence

MIKDYTMTTSKIAVNVLNNQNEQVKVVAAVLIDPVTGLPSDGGGSTGSNIDFELLLIQDSTGATGIRREVNNNGTITVNYETLDGGSWTPTPPTSLVSAALPPNAATASAQATLLTVVQNLLIAAKMPTYSAVTILSVATSASAGATATAFGAQACTGLDIVNNSTVDIEYQRGGAGQFMTISAGTSRLVTGITNANQISVRRVDQVATAVTIKAEAFAV

Physico‐chemical properties

protein length:	220 AA
molecular weight:	22492,09420 Da
isoelectric point:	4,67952
aromaticity:	0,04091
hydropathy:	0,22500

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

ANJ65185.1

1 220 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	97	97	0,9705
Central domain	98	209	113	0,0017
C-terminal	210	220	10	0,9981

Note: Constraints were applied during segmentation.
C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

Erwinia phage vB_EamP_Frozen [NCBI] · taxon 1852641

Uroviricota Caudoviricetes Schitoviridae Johnsonvirus Johnsonvirus frozen

Host No host information

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

ANJ65185.1

ESMFold structure

Source ESMFold

pLDDT 61.9

Oligomeric state monomer

Download structure