Protein

View in Explore

UniProt accession

A0A6J5S169 [UniProt]

Protein name

Major tropism determinant N-terminal domain-containing protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

Evidence RBPdetect

Probability 0,90

Evidence RBPdetect2

Probability 0,99

Protein sequence

MSNTIRIKRRAAGGGAGAPTSLENAELAFNEQTNILYYGTGTGGSGGSATSIIPIAGNGAFVDTSTTQTVGGVKTFSSTISGSIDGNAGTATTLQTSRNISVSGDATGTQSFNGSANADIALTLATVNANVGAFTKITVNAKGLATAASQASLSDLSAPTSSFSMGSQLLTTLLDPVSAQDAATKNYVDNVAQGLNVKAASFATTTGDITLLGLGTQAGGDWAASLTAGDRVLVKNQTLSQNNGIYAASASTWTRTTDANTWSQLVSAFTFVSTGATLSDTGWVCTVDSGGTLGVTPITWVQFSAAGAYFAGTGLTLTGNTFSITNTAVTPASYGNSNGTQTLVATVNAQGQLTALAAYDINVDGGTY

Physico‐chemical properties

protein length:	368 AA
molecular weight:	36730,82920 Da
isoelectric point:	4,46757
aromaticity:	0,06793
hydropathy:	0,08152

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A6J5S169

1 368 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	82	82	0,5517
Central domain	83	281	200	0,0397
C-terminal	282	368	86	0,6869

Note: Constraints were applied during segmentation.
Fixed 35 C-terminal predictions appearing before Central domain

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

uncultured Caudovirales phage [NCBI] · taxon 2100421

Uroviricota Caudoviricetes Peduoviridae Maltschvirus maltsch

Host No host information

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

A0A6J5S169

ESMFold structure

Source ESMFold

pLDDT 79.3

Oligomeric state monomer

Download structure