Protein

View in Explore

Genbank accession

AYP69193.1 [GenBank]

Protein name

tail fiber protein

RBP type

Evidence UniProt/TrEMBL

Probability 1,00

Evidence GenBank

Probability 1,00

TSP

Evidence RBPdetect

Probability 0,61

Evidence RBPdetect2

Probability 0,95

Protein sequence

MKIVDSPAKQGVPFGINGLREPLLPSTPAGDNTASYADGFPSITMILKSAGGLPPKGQDMNQILFELSSLCRWFSAGAMNKFDSAFCTAIGGYPKGSLLLAGDGVTIFKCTQDDNTNNPDQSATGWKRLSYYVADELALGNAAHKDVGTTSGTVAAGDSTMGGTYTNVTSSRAMGVTYTNSATRPMLVIYSCDATSFGTAVAAVNGVTVARFIGVESASTHNGPSMTFIVPPGATYSITKTAGSLSNMIWAEMV

Physico‐chemical properties

protein length:	254 AA
molecular weight:	26344,47510 Da
isoelectric point:	5,62617
aromaticity:	0,08268
hydropathy:	0,02402

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

AYP69193.1

1 254 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	143	143	0,9838
Central domain	144	243	101	0,0234
C-terminal	244	254	10	0,9974

Note: Constraints were applied during segmentation.
C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

Edwardsiella phage Edno5 [NCBI] · taxon 2419942

Uroviricota Caudoviricetes Gofduovirus

Host

Edwardsiella anguillarum [NCBI] · taxon 1821960

cellular organisms Bacteria Pseudomonadati Pseudomonadota Gammaproteobacteria Enterobacterales

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

AYP69193.1

ESMFold structure

Source ESMFold

pLDDT 80.5

Oligomeric state monomer

Download structure