Protein

View in Explore

UniProt accession

A0A4Y5U0S7 [UniProt]

Protein name

Minor tail protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

Evidence RBPdetect2

Probability 0,42

Seq2Symm

I confidence 0,956

I	0,956
C1	0,078
H	0,002

Predicted homo-oligomer symmetry (Seq2Symm, per-class probabilities; C1 = monomer, C2 = dimer, C3 = trimer).

Protein sequence

MVLPAPRFRTTRKWQANNVQPDNSLVVEGSATTNVNLTVGAGAAIIVFVAGNQTAAARVDGVAMTLIGKTSNAAMYGITGLAAGARNVQVDRSGSSAHIVAVLSYTGVSTITGGALGSGSGNTPSGTPSGSGHLAVVGFDFGVSSSDVGSVVSNGNLRQLYRRTAANALAVADKDSAPVTITNPSGGSWTSIGVWLST

Physico‐chemical properties

protein length:	198 AA
molecular weight:	19748,83380 Da
isoelectric point:	9,97592
aromaticity:	0,05051
hydropathy:	0,18485

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A4Y5U0S7

1 198 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	10	10	0,1260
Central domain	11	187	178	0,0011
C-terminal	188	198	10	0,9986

Note: Constraints were applied during segmentation.
Sequence started with non-N-terminal domain|C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

Gordonia phage VanDeWege [NCBI] · taxon 2588131

Uroviricota Caudoviricetes Stackebrandtviridae Wizardvirus Wizardvirus vandewege

Host

Gordonia terrae [NCBI] · taxon 2055

Actinomycetota Actinomycetes Mycobacteriales Gordoniaceae Gordonia Gordonia terrae

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

A0A4Y5U0S7

ESMFold structure

Source ESMFold

pLDDT 88.7

Oligomeric state monomer

Download structure