Protein

View in Explore

UniProt accession

A0A0K1LT43 [UniProt]

Protein name

Uncharacterized protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

Protein sequence

MALKTKPRWDKYDGYVGNYRGVLGEDIDLDTEANRVLAVGTNSNGAIVVGAGQTGIKGLMIVAVGADIHGAMLDGGINNHAGDPQDVGKHGEITNFQPTVFGRTFGVAISATEGNVKLAVNGVDTGNIAYNTSAANLKSGIVAVDDGFTADDFTVTGTAPNFTVVTTRTDVTITASGDGVTVTEATAVAAAGTNYYGHADGTVNAVKGSDGVYVGHTQEADRLIVNVKDEED

Physico‐chemical properties

protein length:	232 AA
molecular weight:	23779,86640 Da
isoelectric point:	4,54333
aromaticity:	0,06034
hydropathy:	-0,09095

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A0K1LT43

1 232 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	120	120	0,0018
Central domain	121	221	102	0,2351
C-terminal	222	232	10	0,5537

Note: Constraints were applied during segmentation.
Fixed 94 C-terminal predictions appearing before Central domain|C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

Mycobacterium phage Madruga [NCBI] · taxon 1675552

Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes

Host No host information

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

A0A0K1LT43

ESMFold structure

Source ESMFold

pLDDT 67.2

Oligomeric state monomer

Download structure