Protein

View in Explore

UniProt accession

E3SI54 [UniProt]

Protein name

Sericin 1-like protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

Evidence RBPdetect

Probability 0,88

Evidence RBPdetect2

Probability 0,52

Protein sequence

MSNIVVNEIHGQDYYNYIIRGDAGMNLLVAGTQSVHPSGQAGFALPKGTTAQRPSSPSAGMIRYNTDNLAVEYYTGSQWRSSGGGTGGTSSNPFTSLAQADAAGVADGLYYFTNGSETKQVYVGNFSGTRFLMITSNNASSGTIPSGNNRRSTSYYVNRSGAGGSTLGTPSPDSDYIIGSWINSFNFSQIKVYGFGRGTTNGSTTWGGNRGTTVEATWNTNSFTSVTPRNQVSVIGELSGSAAYFVGDGIRRDNENGGFNANPNQTTVGGVGVINSSGDPANGCYLGHGSNEGNYEGWYNNSGNANSQGYTTWVR

Physico‐chemical properties

protein length:	315 AA
molecular weight:	33058,17720 Da
isoelectric point:	6,28556
aromaticity:	0,11111
hydropathy:	-0,52349

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

E3SI54

1 315 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	150	150	0,1577
Central domain	151	304	155	0,1210
C-terminal	305	315	10	0,9689

Note: Constraints were applied during segmentation.
Fixed 96 C-terminal predictions appearing before Central domain|C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

Synechococcus phage S-SM1 [NCBI] · taxon 444859

Uroviricota Caudoviricetes Pantevenvirales Thetisvirus Thetisvirus ssm1

Host

Synechococcus sp. WH 6501 [NCBI] · taxon 166310

Bacteria Cyanobacteria Oscillatoriophycideae Chroococcales Synechococcus

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

E3SI54

ESMFold structure

Source ESMFold

pLDDT 53.3

Oligomeric state monomer

Download structure