Protein

View in Explore

UniProt accession

A0A6J5TDE3 [UniProt]

Protein name

Uncharacterized protein

RBP type

Evidence Phold

Probability 1,00

TSP

Evidence DepoScope

Probability 1,00

Evidence RBPdetect

Probability 0,89

TSP

Evidence RBPdetect2

Probability 0,64

Protein sequence

MALPITITYTFATATGSIPLSQLDTNFSTLASAVNGIGDGTNYIIVATNATTNTTPALTFNASNCLWSAGVATSGSYNQVVIQNESASAGASVNYVLSNNLGTDSTYYGEFGMNSSAYTATTYVDFFSMNNGVYFSSHDGDVTVGSGNGFKTYLAWGTTGQSAHVINASGAIGLNTNLGTSAATTGTTNYGTAGQVLVSAGSAATATWSSTPTLTVTNFTGTASININGTVGATTPSTGAFTTFSATSNVVTSVSAATSGLTAVTAVAGSLTLATGGVTLASQTAAAGSVWRVRAYGTYAAASSANVRALTMSCYWGTTQLTAITTGNVLAAVAQTTAWSVEFEVSTTSTTAAWNTGVLSSQVSSATIPLNSVATPASVTVTSGAQTLDFRVGQTGTATATDTINVHQVLMERIK

Physico‐chemical properties

protein length:	415 AA
molecular weight:	41703,33830 Da
isoelectric point:	4,73005
aromaticity:	0,08193
hydropathy:	0,23759

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A6J5TDE3

1 415 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	112	112	0,2100
Central domain	113	311	200	0,1123
C-terminal	312	415	103	0,9996

Note: Constraints were applied during segmentation.
Fixed 118 C-terminal predictions appearing before Central domain

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

uncultured Caudovirales phage [NCBI] · taxon 2100421

Uroviricota Caudoviricetes Peduoviridae Maltschvirus maltsch

Host No host information

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

A0A6J5TDE3

ESMFold structure

Source ESMFold

pLDDT 56.6

Oligomeric state monomer

Download structure