Protein

View in Explore

UniProt accession

A0A7T3KGA8 [UniProt]

Protein name

Receptor binding protein 3

RBP type

Evidence Phold

Probability 1,00

TSP

Evidence DepoScope

Probability 1,00

TSP

Evidence RBPdetect2

Probability 0,99

Protein sequence

MQTAINEANKYMNYSDKSITIKLISDLVINEFINIVNIHSPFLNIDFNGYSITLNNASYDIGFFMYNSILGDINKLKINCNNKSINTAVLLQNNSFCRFNDMKGILNCLGNAFVLSTNSEAYVSGSTCELSAGSSGYFSKGISSIGSKLLCHTCKFTQNSGALSQSVETSGIIDNHNTTFSGSITGKSQVVGTWTKNGYISA

Physico‐chemical properties

protein length:	202 AA
molecular weight:	21919,46590 Da
isoelectric point:	7,57348
aromaticity:	0,09901
hydropathy:	-0,01832

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A7T3KGA8

1 202 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	10	10	0,0103
Central domain	11	191	182	0,9263
C-terminal	192	202	10	0,4306

Note: Constraints were applied during segmentation.
Fixed 6 C-terminal predictions appearing before Central domain|Sequence started with non-N-terminal domain|C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

Campylobacter phage F365 [NCBI] · taxon 2794370

Uroviricota Caudoviricetes Connertonviridae Fletchervirus CPX

Host

Campylobacter jejuni [NCBI] · taxon 197

cellular organisms Bacteria Pseudomonadati Campylobacterota Epsilonproteobacteria Campylobacterales

Coding sequence (CDS)

No CDS data available.

Genome Context

Gene Ontology

	Description	Category	Evidence (source)
GO:0030599	pectinesterase activity	Molecular Function	IEA:UniProtKB-EC (UniProt)

Tertiary structure

A0A7T3KGA8

ESMFold structure

Source ESMFold

pLDDT 75.0

Oligomeric state monomer

Download structure