Protein

View in Explore

UniProt accession

A0A6J5RG08 [UniProt]

Protein name

Uncharacterized protein

RBP type

TSP

Evidence RBPdetect

Probability 0,62

Protein sequence

MSVILGRHVGAAYCQLGDPALTYPDYPGQYARATGQGFFGSSSAYFTTYPSTTPDELVSLIRYKGGYANGLSGQVYVGSTGGQYNGTVETGSPPSPIGGSPFYQDDRTGTASAYTGIVRPRWYTETAFDLQAQAATTGFTPQGIPPGCQFNYAAPGVAGATTNFSVSYETGYCPHDPTMGGGSTYNYDAEFSLIVNLDEVCCWNEGAEIDLEVDIGQTDFTTTYVSGVYGVHDITLGSHSLHSTLSHTLTIDPTMEGTFTVPYIFAIPKASGYFTYVNDVRIVAVRAP

Physico‐chemical properties

protein length:	288 AA
molecular weight:	30656,39050 Da
isoelectric point:	4,46558
aromaticity:	0,13194
hydropathy:	-0,15556

Tail Spike Domain Segmentation

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A6J5RG08

1 288 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	10	10	0,2639
Central domain	11	220	211	0,6706
C-terminal	221	288	67	0,8622

Note: Constraints were applied during segmentation.
Sequence started with non-N-terminal domain

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Taxonomy

Phage

uncultured Caudovirales phage [NCBI] · taxon 2100421

Uroviricota Caudoviricetes Peduoviridae Maltschvirus maltsch

Host No host information

Coding sequence (CDS)

No CDS data available.

Genome Context

Tertiary structure

A0A6J5RG08

ESMFold structure

Source ESMFold

pLDDT 27.8

Oligomeric state monomer

Download structure