Phage RBP Database

UniProt accession

A8E284 [UniProt]

Protein name

Putative minor structural protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

TF

Evidence RBPdetect2

Probability 0,46

Protein sequence

MALNGTKYTAFARHRLVLEWRANQNIAGNYSTISVWLYLQSMDKWGRLDAPAIGDAKVTVEGTTQTEKASSMLNAFQKKLLLAKEWRVNHNNDGSKRITIGGSYFVNVTFTDNGVSTYYGTITIPNFSVDLNRIPRRSSLNPVPTLNLPGNLPITINRQSSTFKHNLTAWVANRDNPTLNNYAHWTYLTNLNDVGTSGAFSFTVANNKTIFTALNNRTSWQGKVKLWTIGLDDVVSQERTYKIVPPMNAQASGGKITLNVGEKINVSLSNYRSDANFTYDGVFNISGLNIPIATNSAGNTMSYTLTQTDVDNILKKIPNADSSWGQVTVTSKYSGVQYRTPWTGQRIDITIPKNKYVPSINGTPTYEDTSNVSVGLTGNNQVALQGKSNIKVTIPANFATANGYSTLKTIDVSLGGTSKTINYSNAETVVELGAPAVELGAPANHTSDTLIVTVTDSRGFKSNWTKHVDIYPYENPNMDFTVARRNNFETTTDINVNSTWSPITIGGVNKNAIQSVTYATKVAGVGTYGAETALNFTANGSMVTVKNTPIELDNTNTYEVRLSVTDKFSTFTRTATVKPGNPIMFIDADNRSLFLGNAFVDNNNNGLRGVLEIERDKWQDRGLVGISLNNSDISAVNGIWFSTDTSDNAGEGIHFIKSGKSRNSLTWDDYDYFYMRDNGFYVNHNTQPIFEVSDTGTMTFPTKQLWKGVVYLNDIQEILPSKKLTECRNGWVLTFSAYESGAGQPWDINQVYIHKSVLNQFNTRGFRAMIGHGTTITFKYMYITDGRIGGHAGNGRGVNSGIVIREVSEW

Physico‐chemical properties

protein length:	810 AA
molecular weight:	89361,77720 Da
isoelectric point:	8,99606
aromaticity:	0,10123
hydropathy:	-0,36704

Domain architecture

A8E284

1 810 aa

STR 22–176 · STR 257–588 ·

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domains

IPR008577
STR

IPR008577 IPR008577

A8E284

1810 aa

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

Novel HMM domains (de novo, PhaRBP-HMM)

Experimental de novo families on regions without InterPro annotation. Separate from the InterPro architecture above.

DC_1676
ATT

DC_1676 DC_0631 DC_1167

A8E284

1810 aa

InterPro domain annotations

Domain ID	Category	Cluster	Start	End	Layer	Name	Pref Zone	Confidence	Evidence	Support
IPR008577	STR	DC_0504	22	176	InterPro cluster	Putative viral structural protein (DUF859)	Central	Low	Positional only	87 proteins / 142 hits
IPR008577	STR	DC_0504	257	588	InterPro cluster	Putative viral structural protein (DUF859)	Central	Low	Positional only	87 proteins / 142 hits

Proteins with similar domain architecture

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A8E284

1 810 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	140	140	0,0268
Central domain	141	389	250	0,7827
C-terminal	390	810	420	0,5306

Note: Constraints were applied during segmentation.
Fixed 110 C-terminal predictions appearing before Central domain

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Phage

Enterococcus phage phiEF24C [NCBI] · taxon 442493

Uroviricota Caudoviricetes Herelleviridae Kochikohdavirus Kochikohdavirus EF24CP2

Host

Enterococcus faecalis [NCBI] · taxon 1351

cellular organisms Bacteria Bacillati Bacillota Bacilli Lactobacillales

No CDS data available.

Protein

Domains

Tail Spike Domain Segmentation

Taxonomy

Coding sequence (CDS)

Genome Context

Tertiary structure

Predicted Aligned Error (PAE)