Protein

View in Explore
Genbank accession
AAD42417.1 [GenBank]
Protein name
gp12 Short tail fibers
RBP type
TF
Evidence RBPdetect
Probability 0,76
Protein sequence
MSNNTYQHVSNESRYVKFDPTDTNFPPEITDVHAAIAAISPAGVNGVPDASSTTKGILFIPTEQEVIDGTNNTKAVTPATLATRLSYPNATETVYGLTRYSTNDEAIAGVNNESSITPAKFTVALNNAFETRVSTESSNGVIKISSLPQALAGADDTTAMTPLKTQQLAIKLIAQIAPSETTATESDQGVVQLATVAQVRQGTLREGYAISPYTFMNSSSTEEYKGVIKLGTQSEVNSNNASVAVTGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVRMTGGYIQGNRIVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGNPSNPGLPDMRGLFVRGSGRGSHLTNPNVNGNDQFGKPRLGVGCTGGYVGEVQIQQMSYHKHAGGFGEHDDLGAFGNTRRSNFVGTRKGLDWDNRSYFTNDGYEIDPESQRNSKYTLNRPELIGNETRPWNISLNYIIKVKE
Physico‐chemical
properties
protein length:527 AA
molecular weight: 56213,58390 Da
isoelectric point:5,89502
aromaticity:0,07021
hydropathy:-0,39886

Domains

Domains [InterPro]
IPR015173
246–326
IPR015173 IPR037053 IPR044916
SSF69349
246–326
SSF69349 SSF88874
G3DSA:2.10.280.10
246–286
G3DSA:2.10.280.10 G3DSA:2.160.30.10 IPR011083 IPR027448
AAD42417.1
1 527
Legend: Pfam SMART CDD TIGRFAM HAMAP SUPFAM PRINTS Gene3D PANTHER Other

Taxonomy

  Name Taxonomy ID Lineage
Phage Escherichia phage T4
[NCBI] 		2681598 Viruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)
Genbank protein accession
AAD42417.1 [NCBI]
Genbank nucleotide accession
AF158101.6 [NCBI]
CDS location
range 90549 -> 92132
strand +
CDS
ATGAGTAATAATACATATCAACACGTTTCTAATGAATCTCGTTATGTAAAATTTGATCCTACCGATACGAATTTTCCACCGGAGATTACTGATGTTCACGCTGCTATAGCAGCCATTTCTCCTGCTGGAGTAAATGGAGTTCCTGATGCATCGTCAACAACAAAGGGAATTCTATTTATTCCCACTGAACAGGAAGTTATAGATGGAACTAATAATACCAAAGCAGTTACACCAGCAACGTTGGCAACAAGATTATCTTATCCAAATGCAACTGAAACTGTTTACGGATTAACAAGATATTCAACCAATGATGAAGCCATTGCCGGAGTTAATAATGAATCTTCTATAACTCCAGCTAAATTTACTGTCGCCCTTAATAATGCGTTTGAAACGCGAGTTTCAACTGAATCCTCAAATGGTGTTATTAAAATTTCATCTCTACCGCAAGCATTAGCTGGTGCAGATGATACTACTGCAATGACTCCATTAAAAACACAGCAGTTAGCTATTAAATTAATTGCGCAAATTGCTCCTTCTGAAACCACAGCTACCGAATCGGACCAAGGTGTTGTTCAATTAGCAACAGTAGCGCAGGTTCGTCAGGGAACTTTAAGAGAAGGCTATGCAATTTCTCCTTATACGTTTATGAATTCATCTTCTACTGAAGAATATAAAGGCGTAATTAAATTAGGAACACAATCAGAAGTTAACTCGAATAATGCTTCTGTTGCGGTTACTGGCGCAACTCTTAATGGTCGTGGTTCTACGACGTCAATGAGAGGCGTAGTTAAATTAACTACAACCGCCGGTTCACAGAGTGGAGGCGATGCTTCATCAGCCTTAGCTTGGAATGCTGACGTTATCCAGCAAAGAGGTGGTCAAATTATCTATGGAACACTCCGCATTGAAGACACATTTACAATAGCTAATGGTGGAGCAAATATTACGGGTACCGTCAGAATGACTGGCGGTTATATTCAAGGTAACCGCATCGTAACACAAAATGAAATTGATAGAACTATTCCTGTCGGAGCTATTATGATGTGGGCCGCTGATAGTCTTCCTAGTGATGCTTGGCGCTTCTGCCATGGTGGAACTGTTTCAGCGTCAGATTGTCCATTATATGCTTCTAGAATTGGAACAAGATATGGCGGAAACCCATCAAATCCTGGATTGCCTGACATGCGTGGTCTTTTTGTTCGTGGTTCTGGTCGTGGTTCTCACTTAACAAATCCAAATGTTAATGGTAATGACCAATTTGGTAAACCTAGATTAGGTGTAGGTTGTACCGGTGGATATGTTGGTGAAGTACAGATACAACAGATGTCTTATCATAAACATGCTGGTGGATTTGGTGAGCATGATGATCTGGGGGCATTCGGTAATACCCGTAGATCAAATTTTGTTGGTACACGTAAAGGACTTGACTGGGATAACCGTTCATACTTCACCAATGACGGATATGAAATTGACCCAGAATCACAACGAAATTCCAAATATACATTAAATCGTCCTGAATTAATTGGAAATGAAACACGTCCATGGAACATTTCTTTAAACTACATAATTAAGGTAAAAGAATGA

Tertiary structure

PDB ID
7217d9ba85295425153753c7471ed13fdcecd6e5368e73a28d704dda3e881f7d
ESMFold
Source ESMFold
Method ESMFold
Resolution 0,6866
Oligomeric State monomer
Download PDB
Model Confidence
Very high
pLDDT > 90
High
90 > pLDDT > 70
Low
70 > pLDDT > 50
Very low
pLDDT < 50

Literature

Title Authors Date PMID Source
rII cistrons of bacteriophage T4. DNA sequence around the intercistronic divide and positions of genetic landmarks Pribnow,D., Sigurdson,D.C., Gold,L., Singer,B.S., Napoli,C., Brosius,J., Dull,T.J. and Noller,H.F. 1981 6273585 GenBank
Nucleotide sequences involved in bacteriophage T4 gene 32 translational self-regulation Krisch,H.M. and Allet,B. 1982 6289325 GenBank
Gene 67, a new, essential bacteriophage T4 head gene codes for a prehead core component, PIP. I. Genetic mapping and DNA sequence Volker,T.A., Gafner,J., Bickle,T.A. and Showe,M.K. 1982 7154087 GenBank
Organization and Structure of Four T4 Genes Coding for DNA Replication Proteins Spicer,E.K. and Konigsberg,W.H. 1983 — GenBank
Nucleotide sequence of the lysozyme gene of bacteriophage T4. Analysis of mutations involving repeated sequences Owen,J.E., Schultz,D.W., Taylor,A. and Smith,G.R. 1983 6302287 GenBank
Primary structure and genetic organization of phage T4 DNA ligase Armstrong,J., Brown,R.S. and Tsugita,A. 1983 6314278 GenBank
Sequence and cloning of bacteriophage T4 gene 63 encoding RNA ligase and tail fibre attachment activities Rand,K.N. and Gait,M.J. 1984 6370680 GenBank
Nucleotide sequence reveals overlap between T4 phage genes encoding dihydrofolate reductase and thymidylate synthase Purohit,S. and Mathews,C.K. 1984 6327673 GenBank
The bacteriophage T4 regA gene: primary sequence of a translational repressor Trojanowska,M., Miller,E.S., Karam,J., Stormo,G. and Gold,L. 1984 6473098 GenBank
Identification and characterization of the alc gene product of bacteriophage T4 Kutter,E., Drivdahl,R. and Rand,K. 1984 6389256 GenBank
Gene 68, a new bacteriophage T4 gene which codes for the 17K prohead core protein is involved in head size determination Keller,B., Sengstag,C., Kellenberger,E. and Bickle,T.A. 1984 6512858 GenBank
Regulation of a new bacteriophage T4 gene, 69, that spans an origin of DNA replication Macdonald,P.M. and Mosig,G. 1984 6098451 GenBank
Nucleotide sequence of bacteriophage T4 gene 23 and the amino acid sequence of its product Parker,M.L., Christensen,A.C., Boosman,A., Stockard,J., Young,E.T. and Doermann,A.H. 1984 6335532 GenBank
Genes 55, alpha gt, 47 and 46 of bacteriophage T4: the genomic organization as deduced by sequence analysis Gram,H. and Ruger,W. 1985 4018026 GenBank
T4 polynucleotide kinase; cloning of the gene (pseT) and amplification of its product Midgley,C.A. and Murray,N.E. 1985 2996886 GenBank
Sequence organization and control of transcription in the bacteriophage T4 tRNA region Broida,J. and Abelson,J. 1985 4057254 GenBank
Sequence of the T4 recombination gene, uvsX, and its comparison with that of the recA gene of Escherichia coli Fujisawa,H., Yonesaki,T. and Minagawa,T. 1985 2932679 GenBank
T4-induced alpha- and beta-glucosyltransferase: cloning of the genes and a comparison of their products based on sequencing data Tomaschewski,J., Gram,H., Crabb,J.W. and Ruger,W. 1985 2999696 GenBank
The nucleotide sequence of gene 21 of bacteriophage T4 coding for the prohead protease Keller,B. and Bickle,T.A. 1986 3552886 GenBank
Characterization of the intron in the phage T4 thymidylate synthase gene and evidence for its self-excision from the primary transcript Chu,F.K., Maley,G.F., West,D.K., Belfort,M. and Maley,F. 1986 3698096 GenBank
The bacteriophage T4 gene for the small subunit of ribonucleotide reductase contains an intron Sjoberg,B.M., Hahne,S., Mathews,C.Z., Mathews,C.K., Rand,K.N. and Gait,M.J. 1986 3530746 GenBank
The 52-protein subunit of T4 DNA topoisomerase is homologous to the gyrA-protein of gyrase Huang,W.M. 1986 3020513 GenBank
Nucleotide sequence of a type II DNA topoisomerase gene. Bacteriophage T4 gene 39 Huang,W.M. 1986 3022233 GenBank
Nucleotide sequence and analysis of the 58.3 to 65.5-kb early region of bacteriophage T4 Valerie,K., Stevens,J., Lynch,M., Henderson,E.E. and de Riel,J.K. 1986 3024113 GenBank
Localization of the T4 phage ribonucleotide reductase B1 subunit gene and the nucleotide sequence of its upstream and 5' coding regions Chu,F.K., Maley,G.F., Wang,A.M. and Maley,F. 1987 3322944 GenBank
The bacteriophage T4 dexA gene: sequence and analysis of a gene conditionally required for DNA replication Gauss,P., Gayle,M., Winter,R.B. and Gold,L. 1987 3553862 GenBank
Identification of two new bacteriophage T4 genes that may have roles in transcription and DNA replication Hsu,T., Wei,R.X., Dawson,M. and Karam,J.D. 1987 3543399 GenBank
Nucleotide sequence and primary structures of gene products coded for by the T4 genome between map positions 48.266 kb and 39.166 kb Tomaschewski,J. and Ruger,W. 1987 3575111 GenBank
Receptor-recognizing proteins of T-even type bacteriophages. Constant and hypervariable regions and an unusual case of evolution Montag,D., Riede,I., Eschbach,M.L., Degen,M. and Henning,U. 1987 2958637 GenBank
Nucleotide sequence of gene t (lysis gene) of the E. coli phage T4 Montag,D., Degen,M. and Henning,U. 1987 3628006 GenBank
A persistent untranslated sequence within bacteriophage T4 DNA topoisomerase gene 60 Huang,W.M., Ao,S.Z., Casjens,S., Orlandi,R., Zeikus,R., Weiss,R., Winge,D. and Fang,M. 4843 2830666 GenBank
Nucleotide sequence of the tail tube structural gene of bacteriophage T4 Arisaka,F., Ishimoto,L., Kassavetis,G., Kumazaki,T. and Ishii,S. 1988 2963141 GenBank
Deoxycytidylate hydroxymethylase gene of bacteriophage T4. Nucleotide sequence determination and over-expression of the gene Lamm,N., Wang,Y., Mathews,C.K. and Ruger,W. 1988 3350013 GenBank
Nucleotide and deduced amino acid sequence of bacteriophage T4 gene 12 Selivanov,N.A., Prilipov,A.G. and Mesyanzhinov,V.V. 1988 3357780 GenBank
Nucleotide sequence of the tail sheath gene of bacteriophage T4 and amino acid sequence of its product Arisaka,F., Nakako,T., Takahashi,H. and Ishii,S. 1988 2964531 GenBank
The structure of three bacteriophage T4 genes required for tail-tube assembly Ishimoto,L.K., Ishimoto,K.S., Cascino,A., Cipollaro,M. and Eiserling,F.A. 1988 3363870 GenBank
Primary structure of T4 DNA polymerase. Evolutionary relatedness to eucaryotic and other procaryotic DNA polymerases Spicer,E.K., Rush,J., Fung,C., Reha-Krantz,L.J., Karam,J.D. and Konigsberg,W.H. 1988 3286635 GenBank
Total sequence, flanking regions, and transcripts of bacteriophage T4 nrdA gene, coding for alpha chain of ribonucleoside diphosphate reductase Tseng,M.J., Hilfinger,J.M., Walsh,A. and Greenberg,G.R. 1988 2846540 GenBank
Nucleotide and deduced amino acid sequence of bacteriophage T4 gene wac Prilipov,A.G., Selivanov,N.A., Nikolaeva,L.I. and Mesyanzhinov,V.V. 1988 3194206 GenBank
Cloning, sequence, and expression of the temperature-dependent phage T4 capsid assembly gene 31 Nivinskas,R. and Black,L.W. 1988 3072258 GenBank
Nucleotide sequences of bacteriophage T4 genes 9, 10 and 11 Prilipov,A.G., Selivanov,N.A., Efimov,V.P., Marusich,E.I. and Mesyanzhinov,V.V. 1989 2726468 GenBank
Nucleotide sequences of bacteriophage T4 genes 13, 14 and 15 Selivanov,N.A., Prilipov,A.G. and Mesyanzhinov,V.V. 1989 2657662 GenBank
Sequencing, cloning and overexpression of genes of bacteriophage T4 between map positions 74.325 and 77.184 Koch,T., Lamm,N. and Ruger,W. 1989 2740234 GenBank
The immunity (imm) gene of Escherichia coli bacteriophage T4 Lu,M.J. and Henning,U. 1989 2746737 GenBank
Bacteriophage T4 late gene expression: overlapping promoters direct divergent transcription of the base plate gene cluster Scarlato,V., Storlazzi,A., Gargano,S. and Cascino,A. 1989 2763463 GenBank
Nucleotide sequence of the alt gene of bacteriophage T4 Hilse,D., Koch,T. and Ruger,W. 1989 2506526 GenBank
Altered expression of the bacteriophage T4 gene 41 (primase-helicase) in an Escherichia coli rho mutant Hinton,D.M. 1989 2668290 GenBank
Organization of the bacteriophage T4 genome between map positions 150.745 and 145.824 Hahn,S. and Ruger,W. 1989 2674900 GenBank
Nucleotide and deduced amino acid sequences of bacteriophage T4 gene 20 Marusich,E.I. and Mesyanzhinov,V.V. 1989 2798102 GenBank
Functional relationships and structural determinants of two bacteriophage T4 lysozymes: a soluble (gene e) and a baseplate-associated (gene 5) protein Mosig,G., Lin,G.W., Franklin,J. and Fan,W.H. 1989 2488704 GenBank
Nucleotide and deduced amino acid sequences of bacteriophage T4 gene 22 Marusich,E.I. and Mesyanzhinov,V.V. 1989 2587226 GenBank
Cloning, sequence analysis, and expression of the bacteriophage T4 cd gene Maley,G.F., Duceman,B.W., Wang,A.M., Martinez,J. and Maley,F. 1990 2136740 GenBank
The bacteriophage T4 gene mrh whose product inhibits late T4 gene expression in an Escherichia coli rpoH (sigma 32) mutant Frazier,M.W. and Mosig,G. 1990 1692800 GenBank
Bacteriophage T4 gene 27 Bova,R., Cascino,A., Cipollaro,M., Grau,O., Micheli,M.R., Santoro,M., Storlazzi,A., Scarlato,V. and Gargano,S. 1990 2349100 GenBank
The rIIA gene of bacteriophage T4. I. Its DNA sequence and discovery of a new open reading frame between genes 60 and rIIA Daegelen,P. and Brody,E. 1990 2379817 GenBank
Bacteriophage T4 DNA packaging genes 16 and 17 Powell,D., Franklin,J., Arisaka,F. and Mosig,G. 1990 2374730 GenBank
The nucleotide sequence of the region of bacteriophage T4 inh(lip)-hoc genes Kaliman,A.V., Khasanova,M.A., Kryukov,V.M., Tanyashin,V.I. and Bayev,A.A. 1990 2377482 GenBank
Nucleotide sequence and control of transcription of the bacteriophage T4 motA regulatory gene Uzan,M., Brody,E. and Favre,R. 1990 2287273 GenBank
Nucleotide sequences of bacteriophage T4 genes 6, 7 and 8 Efimov,V.P., Prilipov,A.G. and Mesyanzhinov,V.V. 1990 2402473 GenBank
Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units Gruidl,M.E., Chen,T.C., Gargano,S., Storlazzi,A., Cascino,A. and Mosig,G. 1991 1871975 GenBank
The nucleotide sequence between genes 31 and 30 of bacteriophage T4 Nivinskas,R., Zajanckauskaite,A., Raudonikiene,A. and Viteniene,I. 1992 1446076 GenBank
Gene rIII is the nearest downstream neighbour of bacteriophage T4 gene 31 Raudonikiene,A. and Nivinskas,R. 1992 1587487 GenBank
Identification of a family of bacteriophage T4 genes encoding proteins similar to those present in group I introns of fungi and phage Sharma,M., Ellis,R.L. and Hinton,D.M. 1992 1631169 GenBank
Sequence and characterization of the bacteriophage T4 comC alpha gene product, a possible transcription antitermination factor Sanson,B. and Uzan,M. 1992 1400206 GenBank
Overexpression, purification, sequence analysis, and characterization of the T4 bacteriophage dda DNA helicase Hacker,K.J. and Alberts,B.M. 1992 1328208 GenBank
The asiA gene of bacteriophage T4 codes for the anti-sigma 70 protein Orsini,G., Ouhammouch,M., Le Caer,J.P. and Brody,E.N. 1993 8416914 GenBank
Analysis of five presumptive protein-coding sequences clustered between the primosome genes, 41 and 61, of bacteriophages T4, T2, and T6 Selick,H.E., Stormo,G.D., Dyson,R.L. and Alberts,B.M. 1993 8383243 GenBank
Direct PCR sequencing of the ndd gene of bacteriophage T4: identification of a product involved in bacterial nucleoid disruption Bouet,J.Y., Woszczyk,J., Repoila,F., Francois,V., Louarn,J.M. and Krisch,H.M. 1994 8163181 GenBank
The ADP-ribosyltransferases (gpAlt) of bacteriophages T2, T4, and T6: sequencing of the genes and comparison of their products Koch,T. and Ruger,W. 1994 8053153 GenBank
Bacteriophage T4 gene 55.9 encodes an activity required for anaerobic ribonucleotide reduction Young,P., Ohman,M. and Sjoberg,B.M. 1994 7961708 GenBank
Bacteriophage T4 gene 28 Bova,R., Cascino,A., Cipollaro,M., Gargano,S., Grau,O., Micheli,M.R., Santoro,M., Scarlato,V. and Storlazzi,A. 1995 7612935 GenBank
Phage T4-coded Stp: double-edged effector of coupled DNA and tRNA-restriction systems Penner,M., Morad,I., Snyder,L. and Kaufmann,G. 1995 7791212 GenBank
Destabilization of bacteriophage T4 mRNAs by a mutation of gene 61.5 Kai,T., Selick,H.E. and Yonesaki,T. 1996 8878669 GenBank
Expression of the bacteriophage T4 DNA terminase genes 16 and 17 yields multiple proteins Franklin,J.L. and Mosig,G. 1996 8921865 GenBank
Bacteriophage T4 UvsW protein is a helicase involved in recombination, repair and the regulation of DNA replication origins Carles-Kinch,K., George,J.W. and Kreuzer,K.N. 1997 9233823 GenBank
A rare type of overlapping genes in bacteriophage T4: gene 30.3' is completely embedded within gene 30.3 by one position downstream Zajanckauskaite,A., Malys,N. and Nivinskas,R. 1997 9272856 GenBank
A phage T4 site-specific endonuclease, SegE, is responsible for a non-reciprocal genetic exchange between T-even-related phages Kadyrov,F.A., Shlyapnikov,M.G. and Kryukov,V.M. 1997 9326373 GenBank
Nucleotide sequence and revised map location of the arn gene from bacteriophage T4 Kim,B.C., Kim,K., Park,E.H. and Lim,C.J. 1997 9387160 GenBank
The roles of the bacteriophage T4 r genes in lysis inhibition and fine-structure genetics: a new perspective Paddison,P., Abedon,S.T., Dressman,H.K., Gailbreath,K., Tracy,J., Mosser,E., Neitzel,J., Guttman,B. and Kutter,E. 1998 9560373 GenBank
The spectrum of acridine resistant mutants of bacteriophage T4 reveals cryptic effects of the tsL141 DNA polymerase allele on spontaneous mutagenesis Wang,F.J. and Ripley,L.S. 1998 9560385 GenBank
The largest (70 kDa) product of the bacteriophage T4 DNA terminase gene 17 binds to single-stranded DNA segments and digests them towards junctions with double-stranded DNA Franklin,J.L., Haseltine,D., Davenport,L. and Mosig,G. 1998 9533879 GenBank
Several new bacteriophage T4 genes, mapped by sequencing deletion endpoints between genes 56 (dCTPase) and dda (a DNA-dependent ATPase-helicase) modulate transcription Mosig,G., Colowick,N.E. and Pietz,B.C. 1998 9858714 GenBank
Two new early bacteriophage T4 genes, repEA and repEB, that are important for DNA replication initiated from origin E Vaiskunaite,R., Miller,A., Davenport,L. and Mosig,G. 1999 10559179 GenBank
An ancient player unmasked: T4 rI encodes a t-specific antiholin Ramanculov,E. and Young,R. 2001 11532126 GenBank
Structural basis for the thioredoxin-like activity profile of the glutaredoxin-like NrdH-redoxin from Escherichia coli Stehr,M., Schneider,G., Aslund,F., Holmgren,A. and Lindqvist,Y. 2001 11441020 GenBank
Intronless homing: site-specific endonuclease SegF of bacteriophage T4 mediates localized marker exclusion analogous to homing endonucleases of group I introns Belle,A., Landthaler,M. and Shub,D.A. 2002 11825876 GenBank
Identification of two middle promoters upstream DNA ligase gene 30 of bacteriophage T4 Truncaite,L., Zajanckauskaite,A. and Nivinskas,R. 2002 11902835 GenBank
The gene e.1 (nudE.1) of T4 bacteriophage designates a new member of the Nudix hydrolase superfamily active on flavin adenine dinucleotide, adenosine 5'-triphospho-5'-adenosine, and ADP-ribose Xu,W., Gauss,P., Shen,J., Dunn,C.A. and Bessman,M.J. 2002 11976345 GenBank
Focused genetic recombination of bacteriophage t4 initiated by double-strand breaks Shcherbakov,V., Granovsky,I., Plugina,L., Shcherbakova,T., Sizova,S., Pyatkov,K., Shlyapnikov,M. and Shubina,O. 2002 12399370 GenBank
Bacteriophage T4 RNA ligase 2 (gp24.1) exemplifies a family of RNA ligases found in all phylogenetic domains Ho,C.K. and Shuman,S. 2002 12228725 GenBank
Bacteriophage T4 genome Miller,E.S., Kutter,E., Mosig,G., Arisaka,F., Kunisawa,T. and Ruger,W. 2003 12626685 GenBank
Analysis of the region between lysozyme and the tRNA genes of bacteriophage T4 Anderson,B., Zurabishvili,T., Marusich,E., Schneider,M., Mullins,T., Napuli,A., Mesyanzhinov,V., Neitzel,J. and Kutter,E. 1981-04 — GenBank
Personal Communication Drake,J.W., Nguyen,D. and Dressman,H. 1992-11-05 — GenBank
Personal Communication Goldberg,E.B. 1993-01-16 — GenBank
Gene 61.3 of bacteriophage T4 is the spackle gene Kai,T., Ueno,H., Otsuko,Y., Morimoto,W. and Yonesaki,T. 1999-08 — GenBank
Bacteriophage T4 genome analysis Kutter,E., Arisaka,F., Kunisawa,T., Tsugita,A., Mosig,G., Mesyanzhinov,V., Ruger,W., Stidham,T. and Thomas,E. 2003-03 — GenBank
The 10.7 kb 'Nonessential' region of Bacteriophage T4 between the genes tk and nrdC: Twenty new T4 genes, generally conserved among T-even phages Mzhavia,N., Djavachishvili,T., Marusich,E., Peterson,S., Anderson,B., Eidemiller,J., Awaya,M., Canada,W., Dimitroff,B., Stidham,T., Blattner,F. and Kutter,E. 1988-11-20 — GenBank
Two New Early Bacteriophage T4 Genes, repEA and repEB, are Important for DNA Replication Initiated from Origin E Vaiskunaite,R., Miller,A., Davenport,L. and Mosig,G. 1999-11-15 — GenBank
Personal Communication Yasuda,G., Parker,M. and Doermann,G. 1988 — GenBank