Protein
- UniProt accession
- Q77MU1 [UniProt]
- Protein name
- Putative baseplate protein
- RBP type
-
TF
evidence: RBPdetect
probability: 0,8785
- Protein sequence
-
MTQYSFPWNDVHGDRLYDADDFMRFFAAFLKTGVVMSFKDGLRVRSTKNGMNIQVGSGSAVIDGGSYLNDKAIGIQVNVASSIQERMDSVVLRMDKNARTTQLFYKPGDTTVARNDTTYELQLAKISVKNNATQITDADITDMRSDFTVCGWSTPFDNINVDGIVDQYKEIFEQKDLEFQAWFKNLKKQLDDNQASNLQNQIDNLGNEKANDHEVVHKTGDESIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGITLSLRKKGTTVEYSIGGEISSKILVNSNLVNLSVPNEFCPRNRCSLVGHMAGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPID
- Physico‐chemical
properties -
protein length: 343 AA molecular weight: 37713,71280 Da isoelectric point: 5,47265 aromaticity: 0,08746 hydropathy: -0,42012
Domains
Domains [InterPro]
No domain annotations available.
Legend:
Pfam
SMART
CDD
TIGRFAM
HAMAP
SUPFAM
PRINTS
Gene3D
PANTHER
Other
Taxonomy
| Name | Taxonomy ID | Lineage | |
|---|---|---|---|
| Phage |
Lactococcus phage phiLC3 [NCBI] |
12390 | Viruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes |
| Host |
Lactococcus lactis subsp. cremoris [NCBI] |
1359 | Bacteria > Firmicutes > Bacilli > Lactobacillales > Streptococcaceae > Lactococcus |
Coding sequence (CDS)
Coding sequence (CDS)
No CDS data available.
Gene Ontology
| Description | Category | Evidence (source) | |
|---|---|---|---|
| GO:0044423 | virion component | Cellular Component | IEA:UniProtKB-KW (UniProt) |
| GO:0007155 | cell adhesion | Biological Process | IEA:InterPro (UniProt) |
| GO:0046718 | symbiont entry into host cell | Biological Process | IEA:UniProtKB-KW (UniProt) |
| GO:0019062 | virion attachment to host cell | Biological Process | IEA:UniProtKB-KW (UniProt) |
Enzymatic activity
No enzymatic activity data available.
Tertiary structure
PDB ID: 115009
Method: ESMFold
Resolution: 0,8581
Evidence: 0,8860
Literature
| Title | Authors | Date | PMID | Source |
|---|---|---|---|---|
| Transcriptional analysis of the genetic elements involved in the lysogeny/lysis switch in the temperate lactococcal bacteriophage phiLC3, and identification of the Cro-like protein ORF76. | Blatny JM, Ventura M, Rosenhaven EM, Risøen PA, Lunde M, Brüssow H, Nes IF | 2003-07 | 12759744 | PubMed |
| Cloning, molecular characterization, and expression of the genes encoding the lytic functions of lactococcal bacteriophage phi LC3: a dual lysis system of modular design. | Birkeland NK | 1994-08 | 7922887 | PubMed |
| Analysis of a regulator involved in the genetic switch between lysis and lysogeny of the temperate Lactococcus lactis phage phi LC3. | Blatny JM, Risøen PA, Lillehaug D, Lunde M, Nes IF | 2001-03 | 11370866 | PubMed |
| A highly efficient and stable system for site-specific integration of genes and plasmids into the phage phiLC3 attachment site (attB) of the Lactococcus lactis chromosome. | Lillehaug D, Nes IF, Birkeland NK | 1997-03-25 | 9099871 | PubMed |
| Characterization of phiLC3, a Lactococcus lactis subsp. cremoris temperature bacteriophage with cohesive single-stranded DNA ends. | Lillehaug D, Lindqvist B, Birkeland NK | 1991-11 | 1840480 | PubMed |
| The cos region of lactococcal bacteriophage phi LC3. | Birkeland NK, Lönneborg AM | 1993 | 8161824 | PubMed |
| Complete genome sequence of the Lactococcus lactis temperate phage phiLC3: comparative analysis of phiLC3 and its relatives in lactococci and streptococci. | Blatny JM, Godager L, Lunde M, Nes IF | 2004-01-05 | 14972551 | PubMed |
| Characterization of genetic elements required for site-specific integration of the temperate lactococcal bacteriophage phi LC3 and construction of integration-negative phi LC3 mutants. | Lillehaug D, Birkeland NK | 1993-03 | 8449882 | PubMed |
| A highly efficient and stable system for site-specific integration of genes and plasmids into the phage φLC3 attachment site (attB) of the Lactococcus lactis chromosome | Dag Lillehaug, Ingolf F Nes, Nils-Kåre Birkeland | 1997-03 | 10.1016/S0378-1119(96)00798-6 | DOI |
| Transcriptional analysis of the genetic elements involved in the lysogeny/lysis switch in the temperate lactococcal bacteriophage ϕLC3, and identification of the Cro-like protein ORF76 | J. M. Blatny, M. Ventura, E. M. Rosenhaven, P. A. Risøen, M. Lunde, H. Brüssow, I. F. Nes | 2003-05-21 | 10.1007/s00438-003-0854-y | DOI |
| Complete genome sequence of the Lactococcus lactis temperate phage φLC3: comparative analysis of φLC3 and its relatives in lactococci and streptococci | Janet Martha Blatny, Linda Godager, Merete Lunde, Ingolf Figved Nes | 2004-01 | 10.1016/j.virol.2003.09.019 | DOI |
| Analysis of a regulator involved in the genetic switch between lysis and lysogeny of the temperate Lactococcus lactis phage φLC3 | — | 2001-01-19 | 10.1007/s004380000407 | DOI |