Protein

View in Explore
UniProt accession
Q9XJP3 [UniProt]
Protein name
Tail spike protein
RBP type
TSP
Evidence DepoScope
Probability 1,00
TSP
Evidence RBPdetect
Probability 0,91
TSP
Evidence RBPdetect2
Probability 0,95
Protein sequence
MTDIITNVVIGMPSQLFTMARSFKAVANGKIYIGKIDTDPVNPENQIQVYVENEDGSHVPASQPIVINAAGYPVYNGQIVKFVTEQGHSMAVYDAYGSQQFYFQNVLKYDPDQFGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI
Physico‐chemical
properties
protein length:623 AA
molecular weight: 67065,69120 Da
isoelectric point:5,09513
aromaticity:0,08668
hydropathy:-0,03435

Domains

Taxonomy

  Name Taxonomy ID Lineage
Phage Shigella phage Sf6
[NCBI] 		2905959 Viruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes
Host No host information

Coding sequence (CDS)

Coding sequence (CDS)

No CDS data available.

Gene Ontology

Description Category Evidence (source)
GO:0098024 virus tail, fiber Cellular Component IDA:UniProtKB (UniProt)
GO:0052775 endo-1,3-alpha-L-rhamnosidase activity Molecular Function IDA:UniProtKB (UniProt)
GO:0044409 symbiont entry into host Biological Process IDA:UniProtKB (UniProt)
GO:0098994 symbiont entry into host cell via disruption of host cell envelope Biological Process IEA:UniProtKB-KW (UniProt)
GO:0098995 symbiont entry into host cell via disruption of host cell envelope lipopolysaccharide Biological Process IEA:UniProtKB-KW (UniProt)
GO:0019062 virion attachment to host cell Biological Process IDA:UniProtKB (UniProt)

Tertiary structure

1 / 7
PDB ID
Source
Method
Resolution
Oligomeric State

Literature

Title Authors Date PMID Source
Enzymic and molecular properties of base-plate parts of bacteriophage P22. Iwashita S, Kanegasaki S 1976-05-17 6284 PubMed
The tailspike protein of Shigella phage Sf6. A structural homolog of Salmonella phage P22 tailspike protein without sequence similarity in the beta-helix domain. Freiberg A, Morona R, Van den Bosch L, Jung C, Behlke J, Carlin N, Seckler R, Baxa U 2003-01-17 12424253 PubMed
An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6. Müller JJ, Barbirz S, Heinle K, Freiberg A, Seckler R, Heinemann U 2008-05 18462681 PubMed
Enzymic and Molecular Properties of Base-Plate Parts of Bacteriophage P22 Shintaro IWASHITA, Shiro KANEGASAKI 1976-05 10.1111/j.1432-1033.1976.tb10392.x DOI
The Shigella flexneri bacteriophage Sf6 tailspike protein (TSP)/endorhamnosidase is related to the bacteriophage P22 TSP and has a motif common to exo- and endoglycanases, and C-5 epimerases James E. H. Chua, Paul A. Manning, Renato Morona 1999-07-01 10.1099/13500872-145-7-1649 DOI
The Tailspike Protein of Shigella Phage Sf6 Alexander Freiberg, Renato Morona, Luisa Van Den Bosch, Christiane Jung, Joachim Behlke, Nils Carlin, Robert Seckler, Ulrich Baxa 2003-01 10.1074/jbc.m205294200 DOI
An Intersubunit Active Site between Supercoiled Parallel β Helices in the Trimeric Tailspike Endorhamnosidase of Shigella flexneri Phage Sf6 Jürgen J. Müller, Stefanie Barbirz, Karolin Heinle, Alexander Freiberg, Robert Seckler, Udo Heinemann 2008-05 10.1016/j.str.2008.01.019 DOI