Phage RBP Database

UniProt accession

A0A6J5PWG7 [UniProt]

Protein name

Uncharacterized protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

TF

Evidence RBPdetect

Probability 0,53

TSP

Evidence RBPdetect2

Probability 0,90

Seq2Symm

C3 confidence 0,999

C3	0,999
D3	0,020
C1	0,008

Predicted homo-oligomer symmetry (Seq2Symm, per-class probabilities; C1 = monomer, C2 = dimer, C3 = trimer).

Protein sequence

MAYSGKKNHSIAQQKTVASTPETPEGGYSKLYPKNDGSWYQLDDTGTESQVGGGGSSIIVSGGGTCSTLRDNNFNQAAGNCSTALGYCNTASSEYSTISGGCGNVAGYTGTVGGGRGNDINCGVAGTIAGGCNNIVAGSYSSIGGGFTNIVTSSGSHSSISGGCCNTVSGQYSSISGGRQNYTCGNSAVISGGIQNYTGGIASVVGGGCCNVANSTCGNGSVISGGYCNTASSFYSTIGGGRWNAVSSAGSIVSGGECNIVCATGAWSSLGGGRGNTASGLASTIAGGCNNTAIGACSIVGGGRTNAATGQGSTIAGGWNNTSSGARSTISGGYYNTSSLYQSFVGGGFCNTASNSYSTVGGGATNTSSGNTSTVGGGLSNTASGVKSTVGGGRANTASGSYSTISGGFNITATCSYST

Physico‐chemical properties

protein length:	419 AA
molecular weight:	40224,77440 Da
isoelectric point:	8,21303
aromaticity:	0,06921
hydropathy:	-0,12864

Domain architecture

A0A6J5PWG7

1 419 aa

STR 104–216 · STR 259–419

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domains

IPR011049
STR

IPR011049 IPR011049 IPR011049

A0A6J5PWG7

1419 aa

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

Novel HMM domains (de novo, PhaRBP-HMM)

Experimental de novo families on regions without InterPro annotation. Separate from the InterPro architecture above.

DC_0642
STR

DC_0642 DC_0642

DC_0621
STR

DC_0621 DC_0642

A0A6J5PWG7

1419 aa

InterPro domain annotations

Domain ID	Category	Cluster	Start	End	Layer	Name	Pref Zone	Confidence	Evidence	Support
IPR011049	STR	IPR011049	104	216	Merged direct domain	Serralysin-like metalloprotease, C-terminal	Central	Low	Positional only	81 proteins / 81 hits
IPR011049	STR	IPR011049	259	349	Merged direct domain	Serralysin-like metalloprotease, C-terminal	Central	Low	Positional only	81 proteins / 81 hits
IPR011049	STR	IPR011049	350	419	Merged direct domain	Serralysin-like metalloprotease, C-terminal	Central	Low	Positional only	81 proteins / 81 hits

Proteins with similar domain architecture

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A6J5PWG7

1 419 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	51	51	0,0010
Central domain	52	408	358	0,9235
C-terminal	409	419	10	0,7337

Note: Constraints were applied during segmentation.
Fixed 70 C-terminal predictions appearing before Central domain|C-terminal too short, adjusted boundary

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Phage

uncultured Caudovirales phage [NCBI] · taxon 2100421

Uroviricota Caudoviricetes Peduoviridae Maltschvirus Maltschvirus maltsch

Host No host information

No CDS data available.

Protein

Domains

Tail Spike Domain Segmentation

Taxonomy

Coding sequence (CDS)

Genome Context

Tertiary structure

Predicted Aligned Error (PAE)