Protein
- UniProt accession
- A0A2L1IYN6 [UniProt]
- Protein name
- Hydrolase
- RBP type
-
TSPTSP
- Seq2Symm
-
C1 confidence 0,824
Predicted homo-oligomer symmetry (Seq2Symm, per-class probabilities; C1 = monomer, C2 = dimer, C3 = trimer).C1 0,824 C3 0,526 C2 0,006 - Protein sequence
-
MSISRLGGISRIHRNGVDLIQVRRGSQLIWSSNILLDTFNRDDANTLGEHWTSTGTGYKLGISSGGARLAVPDGLVALELNTDYARFNAATLDGDDYDLEIVVGSKGASDSITGTKHRTEVFARGSNTGVTHGVGIDLYGSAVSIVRRVASVNTIMKAGGAYAPGDRVRLRGVGNLHNLYVNGEFRVQWNDSSGTAQKGSGYRSLILRADGSKDLLGPRRFSASIDSVQLA
- Physico‐chemical
properties -
protein length: 231 AA molecular weight: 24610,17520 Da isoelectric point: 9,46700 aromaticity: 0,06494 hydropathy: -0,22294
Tail Spike Domain Segmentation
Segmented into three structural domains: N-terminal, central, and C-terminal.
Domain layout
A0A2L1IYN6
1
231 aa
| Domain | Start | End | Length (AA) | Confidence |
|---|---|---|---|---|
| N-terminal | 1 | 220 | 220 | 0,0385 |
| Central domain | 221 | 220 | 1 | 0,5877 |
| C-terminal | 221 | 231 | 10 | 0,6631 |
Note: Constraints were applied during segmentation.
Fixed 211 C-terminal predictions appearing before Central domain|C-terminal too short, adjusted boundary
Fixed 211 C-terminal predictions appearing before Central domain|C-terminal too short, adjusted boundary
N-terminal
Central domain
C-terminal
View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.
Taxonomy
Coding sequence (CDS)
No CDS data available.
Genome Context
Gene Ontology
| Description | Category | Evidence (source) | |
|---|---|---|---|
| GO:0016787 | hydrolase activity | Molecular Function | IEA:UniProtKB-KW (UniProt) |