Phage RBP Database

UniProt accession

A0A7S9SWE5 [UniProt]

Protein name

Capsid and scaffold protein

RBP type

TSP

Evidence DepoScope

Probability 1,00

TF

Evidence RBPdetect2

Probability 0,54

Protein sequence

MALSGSKYTAFARHRLVLEWRASQNVAGNYSDVSIWLYLQSMDSYGALYAPAVGQAQVTANGVKQTENATSQLNAYQKKLLLAKVWRVNHNADGSKSFSISASYFVNVTYSGVYYGTISIPSFSVSLNKIPRKSSLNPVPDLNIPNKLGVSITRQSSSFTHNLTVWVANRTNPTLDNDSHWVYLNSIENVGTSGTFTFSVANFTEMFKRMGTSTEWVGKVKLWTNGLSESVPSQQRTFRIKPPMNAQASGGKLKVKAGEKITVSLSNFQSDGNFKYTGVFXYRGVSIPVATNVHANSMTLTLTQANVDSILKESPDDAGTWGQVRVTSYYNGVQYRTPWNGQHIDCTIPKEDYLPVINGTPTYTDLSAEATNVTGSNQVALQSKSNIRVTIPANFATGQGFSTIKTVQASLGGATKTANYNASGFNIDIGAPNEGTASTLVVTVLDGRGFSTSWTKTVQVYPYSNPDVNYTIARRNNFEVDTELAVSSSWAPVTIGGVNKNAITSVTYATKRSGTSTWGEETPVTFSTDGAKVIVPTTVVQLPNEYSWNFRLTIKDKFGSFSKEANISAGKPIMFIDAVRESVGFGNLTGTGENRNLNGVIEIEAERYHTTGKTGIQMNNSDISGLNGIYFSNDVMDNNGEGLHFIKSGKEVNSPDKKDYDYMYMRDGGFYVNHDGTPIFKVTDNGRMYYPASHLWSGGWYMSGTQNITPSKPMSQCRNGWVLMWAKYQNNTQTWNDVVQVYLGKDLVTTHSGLGVRLLFGGYGNVVIHKYLTITDTEVRGNAQNTNTSLNADRAILVRVHEW

Physico‐chemical properties

protein length:	803 AA
molecular weight:	88024,33700 Da
isoelectric point:	9,10759
aromaticity:	0,10599
hydropathy:	-0,35000

Domain architecture

A0A7S9SWE5

1 803 aa

STR 21–241 · STR 256–609 ·

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

InterPro domains

IPR008577
STR

IPR008577 IPR008577

A0A7S9SWE5

1803 aa

ATT Attachment Domain STR Structural Domain RBD Receptor-Binding Domain CBM Carbohydrate-Binding Module LEC Lectin-like Domain ENZ Enzymatic Domain CHP Intramolecular Chaperone LNK Linker/Spacer Domain TAS Tail-Associated Structural TTP Tail Tubular Protein UNK Uncharacterized Domain Unmapped

Novel HMM domains (de novo, PhaRBP-HMM)

Experimental de novo families on regions without InterPro annotation. Separate from the InterPro architecture above.

DC_1676
ATT

DC_1676 DC_0631 DC_1167

A0A7S9SWE5

1803 aa

InterPro domain annotations

Domain ID	Category	Cluster	Start	End	Layer	Name	Pref Zone	Confidence	Evidence	Support
IPR008577	STR	DC_0504	21	241	InterPro cluster	Putative viral structural protein (DUF859)	Central	Low	Positional only	87 proteins / 142 hits
IPR008577	STR	DC_0504	256	609	InterPro cluster	Putative viral structural protein (DUF859)	Central	Low	Positional only	87 proteins / 142 hits

Proteins with similar domain architecture

Segmented into three structural domains: N-terminal, central, and C-terminal.

Domain layout

A0A7S9SWE5

1 803 aa

Domain	Start	End	Length (AA)	Confidence
N-terminal	1	132	132	0,0008
Central domain	133	388	257	0,8101
C-terminal	389	803	414	0,5270

Note: Constraints were applied during segmentation.
Fixed 115 C-terminal predictions appearing before Central domain

N-terminal Central domain C-terminal

View these domains on the 3D structure via the Color by → Tail spike option in the Tertiary structure section below.

Phage

Enterococcus phage EFGrNG [NCBI] · taxon 2777301

Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes

Host

Enterococcus faecalis [NCBI] · taxon 1351

cellular organisms Bacteria Bacillati Bacillota Bacilli Lactobacillales

No CDS data available.

Protein

Domains

Tail Spike Domain Segmentation

Taxonomy

Coding sequence (CDS)

Genome Context

Tertiary structure

Predicted Aligned Error (PAE)